PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00032.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 346aa    MW: 38902.8 Da    PI: 8.4913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00032.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.5e-071452148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++ Ed++l++ +  +G g       +++  R++k+c++rw +yl
  Rsa1.0_00032.1_g00007.1 14 RGLWSPKEDKKLINFISTYGHG-------CLQ--RCGKSCRLRWINYL 52
                             788*****************99.......998..************97 PP

2Myb_DNA-binding47.15.5e-1558100145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg+++ +E  l+++++ +lG++ W+ Ia++++ gRt++++k++w+
  Rsa1.0_00032.1_g00007.1  58 RGSFSSQESALIIELHSLLGNR-WAQIAKHLP-GRTDNEVKNFWN 100
                              899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-15655IPR009057Homeodomain-like
PROSITE profilePS512948.965952IPR017930Myb domain
SuperFamilySSF466892.81E-231199IPR009057Homeodomain-like
SMARTSM007171.3E-41354IPR001005SANT/Myb domain
PfamPF002492.1E-61452IPR001005SANT/Myb domain
PROSITE profilePS5129424.80453107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2456107IPR009057Homeodomain-like
SMARTSM007171.0E-1457105IPR001005SANT/Myb domain
PfamPF002497.8E-1458101IPR001005SANT/Myb domain
CDDcd001671.74E-1060100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPK EDKKLINFIS TYGHGCLQRC GKSCRLRWIN YLRPDLKRGS  60
FSSQESALII ELHSLLGNRW AQIAKHLPGR TDNEVKNFWN SSIKKKLMSR HHLNHHISSM  120
ASLLTNLPCH NGFNATNGDD EGSRFMSNII ITNTNPNFIT PSHLSLPSPH VMAPSMFPTS  180
SEGDFKFPTT TNTNQSHQDN SLYKNLDIFS ATPMTNSHHH HHYDNDSQWS SLPDLPASTI  240
CSYQETIQDY NDGNKVFVTP YNSNGDDLRS IPLVATKLLC GQVLENKIIS SSPVSQAHDL  300
LIPTRYNLQM PGDHHRVDSY INHMIIPSSS SSPSLSPISC GQYVIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28141077108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759971e-166AF175997.1 Arabidopsis thaliana putative transcription factor (MYB26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146436.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_009146437.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9SPG31e-158MYB26_ARATH; Transcription factor MYB26
TrEMBLM4EF270.0M4EF27_BRARP; Uncharacterized protein
STRINGBra027389.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-148myb domain protein 26